BIKE Protein
SKU: 19918358787

BIKE Protein

Sale price$345.15 Regular price$383.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BIKE ProteinProduct Specification Species Human Accession Q9NSY1 1 Amino Acid Sequence S38 E345 SVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASE Expression System Baculovirus InsectCells Molecular Weight 36.

Product Specification


Species Human
Accession Q9NSY1-1
Amino Acid Sequence

S38-E345

SVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASE

Expression System Baculovirus-InsectCells
Molecular Weight

36.8 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Liquid
Storage Buffer 20 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19918358787

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 147 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Erin Allen
Alexandria, US
★★★★★ 5
Read this review. This pillow saved me.
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I have to testify about this pillow, my brothers and sisters. Ever since I hit my 30s, my body has gone down. Aches and pains. Pops. Crackles. Snaps. It’s ridiculous. Over the last 2 years, I have managed to injure a muscle in my shoulder and the pain is unbearable when it is inflamed. I finally narrowed it down to the pillow I was sleeping on. I have an attachment to a pillow I’ve owned for over 20 years - that’s another story. I could fold it 3 times and it was finally thick enough to support my head. My shoulder got so tore up recently that I had to go through 2 rounds of steroids plus round the clock ibuprofen. Waking up in the night, the whole ordeal. I ordered this pillow after much research all over the internet. I was appalled by the $165 price ticket. But when you’re in that level of pain, you’re just about willing to do whatever it takes. The first night I immediately noticed I got more consecutive hours of sleep than I had in weeks. A week later and my shoulder is pain free. I could’ve cried. The height of this pillow stabilizes my neck and shoulders perfectly. It is firm, but gives and contours to your neck and head. It’s a heavy pillow but I don’t even care. Truly I don’t think I’ll ever go back. This pillow has saved my shoulder and I’ll never stop thanking God for it. If you’re experiencing back, shoulder, or neck pain and are considering this pillow, just order it. Please. Just do it. I’m forever changed. But I’m still keeping 20 year old pillow… just for sentimental purposes. 😂
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
J
Verified Purchase
Jacky Liu
Los Angeles, US
★★★★★ 5
Really good pillows
Number of Items: 1, Number of Items: 1
I’ve been using this pillow for a while now and it’s honestly one of the most comfortable pillows I’ve tried. It has a soft, cloud-like feel but still gives enough support for my neck and shoulders. I’m a side sleeper and it keeps its shape well through the night. The material feels high quality, and it doesn’t go flat like cheaper pillows. Definitely improved my sleep quality and worth the purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
D
Verified Purchase
DPLK
Carnegie, US
★★★★★ 5
Soft AND supportive
Number of Items: 1
I knew I needed a very soft pillow - all the foam pillows I had bought recently to try to upgrade our home pilllow selection seemed ok to the touch but were still too firm once I tried them out, but recently I also had some neck pain that needed some gentle support and the old old foam pillow I had that was so very soft was losing its supportive qualities and the pain wasn’t getting better. This one seemed by description to fit the bill- very soft by the company’s own definition but also with support. I’m happy to report this is exactly as advertised- the softest foam pillow I’ve tried out of the box but also good support. Pain has improved since I started using this pillow. I would buy more if we need more pillows, it’s perfect for me and I think would be comfortable for most people. I think you just need to figure out how firm you need your pillow and also height preference . I’m an all over sleeper -back, side, even belly sometimes, so it’s fine for me, but it is a little taller compared to other pillows I’ve bought recently. I didn’t compare/try other prominent pillow brands, mostly my experience is Ikea (my daughter uses a very flat and nice foam pillow from them that is even a little pricier than this one and it works well for her), and whatever brands happen to be available at target and Costco. This price point for a name brand is reasonable, I think; I was looking at other brands way over $100, and I was willing to spend that much for something that would work long term, so this one working was great. Also, this definitely does not have any cooling effect technology, which is fine by me, but something to consider if you do like cool pillows. (Although, PSA: I recently had to throw away older foam pillows that had those cooling gel panels because the gel panels started disintegrating into sticky ooze; gross and had to throw away whole pillow because couldn’t dissociate from rest of the pillow. Sad cuz the foam part of those pillows were fine.) Anyway, if you like softer pillows but want good support, this one works well and is worth trying!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2025
L
Verified Purchase
Lori Wornom
San Leandro, US
★★★★★ 4
Flatter than a regular pillow but nice and soft
Number of Items: 1
Is it softer than a typical memory foam pillow? Yes. But it’s also a lot flatter. I don’t find this pillow rebounds very well. It’s good for stomach sleepers but not so much for side sleepers. I’m a 2/3 of the night side sleeper so it’s unfortunately not my magic pillow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
M
Verified Purchase
Matt
Draper, US
★★★★★ 5
Best pillow for my neck pain.
Number of Items: 1
I've tried so so many pillows to relieve my neck pain at night and this one is the first pillow that has actually worked. I was skeptical at first as this pillow is heavy and dense but one night and I was hooked. I couldn't believe I found a pillow that actually not only was comfortable but also relieved my neck strain. It's worth the cost to now be able to wake up without pain.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products