Biotinylated CD40 Fc&Avi Tag Protein, Human
SKU: 33621356056

Biotinylated CD40 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD40 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc & Avi Tag EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

55-60kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A, et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-83.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-17.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-14.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33621356056

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 2341 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
D.L. OHollaren, Jr.
Carnegie, US
★★★★★ 3
fit
Snug fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025
S
Verified Purchase
Shopper scott
Omaha, US
★★★★★ 5
Ordering one of each color
Color: Dark Grey, Size: X-Large
Good quality for price. Probably the best item i have ever bottom off Amazon and this int a lie. I love this 1/4 zip vest. Works perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
A
Verified Purchase
Amazon Customer
Louisville, US
★★★★★ 1
To heavy
Color: Black, Size: X-Large
Vest is heavy and frankly very warm can’t see in what environment I’d wear it because at 40-50 I would use light down coat with sleeves I returned from t same day I reviewed it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2026
E
Verified Purchase
Eric dyerly
Los Angeles, US
★★★★★ 5
Golf vest
Color: Black, Size: XX-Large
Very comfortable! Well made! Looks good and great price! Wish it had pockets but other than that great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
R
Verified Purchase
Rick J
Draper, US
★★★★★ 5
Great Vest
this golf vest is amazing. It’s very well-made. It fits well, I’m a double X and I’m 62 and a slice of pizza from 230 pounds. I just love it and plan to buy more. I believe it’s gonna wear very well, but I’ll let you all know in a month or two after I’ve worn it a couple times and washed it a couple times.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026

recommand products