Human Doublecortin, His tag
SKU: 53699894690

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53699894690

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 2256 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lauren B
Omaha, US
★★★★★ 5
A Fox Amongst the Wolves
Format: Kindle
Collette has been forgotten about her whole life. Her parents don't bother with her, others don't try either once they realize she uses sign language to speak, and she's a shifter surrounded by humans that hate her kind. On her 18th birthday, she runs away. She takes the train and then bus wherever it can get her as far from home as possible. A missed bus brings her and a mysterious but kind man to Willowdale. What happens next is a story of fated mates, shifters, magic, new best friends and found family, and a stolen child. I'm sad this was a shorter read but only because of how much I loved Collette, Dylan, Hunter, Luca, Lena, and the others in their community. I love how detailed the characters are even with the shorter story. You can tell their characteristics easily, and the lead in to book two is done so well. I loved this insta love book with just the right amount of drama.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2025
C
Verified Purchase
Common-Sense-Is-Key
Whiting, US
★★★★★ 4
An easy PNR book to cure book hangovers.....
Format: Kindle
I enjoyed this as a short story; but nothing truly pulled me into this world to want to keep reading each story. I can sense the overarching villain arc w/ the HAF; yet it still wasn't enough to capture me long-term. It felt like too much focus was placed on progressing the romance part that everything else took a non-existent back seat. This did work well for my intentions of getting over a book-hangover slump. So there's that lol. A Tip to overcome a PNR book hangover, from a wonderful series or novel......read a trope-y, lighthearted, PNR that is easily predictable but adorable. Like this book. Honestly, I'm rarely into short stories that are turned into a ridiculous amount of books on different PNR characters. So I'm not the best at judging the merits of these stories. I'm a long-haul type of reader that lives for a series surrounding 1 lead female character & her harem (or singular partner). Occassionally, I'll find a series of short stories that are interesting enough to finish or pull me in completely. The rarity of that is countable on 1.5 hands, compared to the literal hundreds of fiction books I've read lol. With all of that, I will say this was fun because of the FMC's difficulties growing up & how that made her strong, the end reveals of her life, & the cute Epilogues. I never felt truly connected to any of the characters; but I did feel slightly compelled to just finish it to see how plot points would end. Unfortunately, due to a lack of character backstory explanations, I still don't understand Collete's "magic". Very little time was given to flesh out the backstory of the world this occurs in. I couldn't even guess what type of magic occurs in this world, aside from what little was revealed. A random scene sticks out to me...... we're introduced to a new magic type, in passing. No dialogue to expand. No hint at anything really. Then the scene moves on. That moment felt pointless to even mention, afterwards. It felt like the author was more concerned w/ romance than storyline. This is a common issue I have w/ short stories....authors write them for whatever reason; but too often it's an "either or" theme.....EITHER the author is writing ONLY for romance w/ storyline taking a minor role OR writing ONLY for storyline w/ some romance that ends up feeling forced. As I mentioned earlier, only a handful of short stories series have ever had a balance of both sides, for me, that I wanted to read all of them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2021
D
Verified Purchase
Darcie Reads A Lot
Natrona Heights, US
★★★★★ 5
Great RH shapeshifting romance!
Format: Kindle
Oh my gosh, I adored this book! Voiceless is set in a blended reality with humans, witches, and shapeshifters of all kinds, but with a significant lack of acceptance from the humans that results in violence. And I am sucker for fated-mates/insta-connection and you get that in heaps and bounds in Voiceless! Colette’s introduction to the supernatural world added some challenges on top of not being able to effectively communicate with those around her. I enjoyed the overall plot; that there was danger and confrontation and resolution, albeit not nearly as much as I wanted. Voiceless is a short read and things escalate at a fast pace and a resolution is reached just as quickly. As a result, I think we miss out a bit on relationship and character development that we could’ve had if the book was little longer. While this is a RH/why-choose, most, if not all of the spice, is exclusively MF.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2025
J
Verified Purchase
Jenny From The Bog
Port Orchard, US
★★★★★ 3
Cute
Format: Kindle
Very insta-love, but also cute with likable characters. The plot was good, though lacking in depth. The spice was fairly abrupt and lack-luster. Am enjoyable read, overall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
C
Verified Purchase
Caylee T.
Waukegan, US
★★★★★ 5
Another great story from this author!
Format: Kindle
I absolutely loved this book. Colette’s story was so sad yet sweet in the sense that yes she ran away from her controlling parents after hearing about arrangements being made for her. But sweet because fate was working in her favor because she ran into one of her mates on the bus. Turns out she had two more back in the town she was heading for. Dylan, Luca, & Hunter turned out to be exactly what Colette needed because the ease with which she felt comfortable around was just perfect. This was a fast burn with a pretty quick paced story as well, especially at towards the end, it all picked up pretty quickly towards the end. I absolutely loved the sweet factor & the epilogues were perfect. Amazing job!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2025

recommand products