Human INOS, His tag
SKU: 62560761731

Human INOS, His tag

Sale price$123.75 Regular price$137.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human INOS, His tagProduct Specification Species Human Synonyms Hepatocyte NOS (HEP NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl cysteine S nitrosylase NOS2, NOS2A Accession P35228 Amino Acid Sequence Protein sequence (P35228, Ala2 Cys200, with C 10*His)

Product Specification


Species Human
Synonyms Hepatocyte NOS (HEP-NOS), Inducible NO synthase (Inducible NOS; iNOS), NOS type II, Peptidyl-cysteine S-nitrosylase NOS2, NOS2A
Accession P35228
Amino Acid Sequence

Protein sequence (P35228, Ala2-Cys200, with C-10*His) ACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 43-55 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Nitric oxide synthases (NOSs) are a family of enzymes catalyzing the production of nitric oxide (NO) from L-arginine. NO is an important cellular signaling molecule. It helps modulate vascular tone, insulin secretion, airway tone, and peristalsis, and is involved in angiogenesis and neural development. Nitric oxide is mediated in mammals by the calcium-calmodulin controlled isoenzymes eNOS (endothelial NOS) and nNOS (neuronal NOS). Nitric oxide synthase, inducible (iNOS) is an enzyme which is encoded by the NOS2 gene in humans and mice. INOS involved in immune response, binds calmodulin at physiologically relevant concentrations, and produces NO as an immune defense mechanism. In mice, the function of Nos2 in immunity against a number of viruses, bacteria, fungi, and parasites has been well characterized. Nos2 is important for protective immunity against CMV.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 62560761731

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2416 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dr. Nemo
Waukegan, US
★★★★★ 5
Liquid facial magic!
Scent: Coconut Water, Size: 12 Fl Oz (Pack of 1)
I love this stuff. I use it daily as part of my facial routine and it has become one of those products I don’t even think about anymore because it just works. It smells good without being overpowering and does a great job of helping control excessive oil buildup on my face. Nothing harsh, nothing drying, just clean and refreshed skin. Right after using this, I follow up with a facial moisturizer and the combo works beautifully. My skin feels balanced instead of tight or angry, which is exactly what I’m going for. I know the label says men can use this as an aftershave, but that’s a hard pass for me. I stick to soothing, purpose-built post-shave products, specifically from Wholly Kaw. That stuff smells like it was handcrafted by skincare deities who truly care about your face. This toner is staying firmly in the “daily skincare” lane, where it shines. Another big plus is how gentle it is. No burning, no weird tingling, no regret. Just a calm, refreshing step that makes my skin feel like it’s being treated with respect. And the price? Under $10. That alone keeps me coming back. Honestly, I think they could charge a few dollars more for how well this performs, but I won’t complain about paying less for fantastic facial liquid magic. Simple, effective, affordable, and a permanent part of my routine. My face approves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
G
Verified Purchase
Gina Arnone
Belleville, US
★★★★★ 5
THAYERS Lavender Witch Hazel Toner: Time-Tested Elegance in a Bottle!
Scent: Lavender, Size: 12 Fl Oz (Pack of 1)
Embarking on a journey down memory lane with THAYERS Lavender Witch Hazel Facial Toner has been nothing short of a delightful reunion. This timeless brand, known since my youth, has proven its mettle yet again. Let's dive into the aromatic, moisturizing wonder that is the Lavender Witch Hazel Toner: Quality Infused with Elegance (5/5): THAYERS brings a touch of timeless elegance to skincare, and this lavender-infused toner is no exception. The quality is unmistakable, leaving my skin feeling pampered and rejuvenated after each use. Cleansliness at its Best (5/5): The toner's prowess in cleansing is unparalleled. It effortlessly removes dirt and impurities, unveiling a refreshed and squeaky-clean complexion. My skin thanks me for this daily ritual of cleanliness. Moisturizing Magic (5/5): The moisturizing effect is like a gentle caress for the skin. Unlike some toners that leave your face feeling parched, THAYERS Lavender Toner ensures that my skin is not just clean but incredibly moisturized after every application. Refreshing Elixir (5/5): Ah, the refreshing burst of lavender! While opinions on the strength of the scent may vary, I find the lavender notes to be a delightful touch. The toner rejuvenates not just my skin but also my senses, making each application a mini spa moment. Better than the Expensive Competitors (5/5): Sometimes the best things come in unassuming packages. Users have attested that this toner outshines even pricier competitors, proving that quality doesn't always have to break the bank. Mixed Durability Verdict (4/5): Opinions are divided on durability, but for me, the overall benefits outweigh any minor considerations. The toner's efficacy in daily use makes it a staple in my skincare routine. Generations-Long Trust (5/5): THAYERS is a brand that has stood the test of time, transcending generations. Its legacy of trustworthiness extends beyond my own experience, connecting with others who have relied on its skincare wonders. Lavender Scent Aspiration (4/5): While I had hoped for a stronger lavender scent, the subtle notes are still a pleasant addition to my skincare ritual. The product's efficacy compensates for any scent expectations. In conclusion, THAYERS Lavender Witch Hazel Facial Toner is a testament to the enduring charm of a trusted brand. Its quality, cleanliness, and moisturizing benefits make it a staple in my skincare routine and a connection to the past. Whether you're a longtime fan or a newcomer, this toner is a timeless treasure for your skin. Cheers to THAYERS for continuing to deliver skincare excellence!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2024
A
Verified Purchase
Ashley Harmon
Massapequa, US
★★★★★ 5
Lasts awhile! Good product
Scent: Rose Petal, Size: 12 Fl Oz (Pack of 1)
Cleans without overdrying. Leave skin feeling clean, no stickiness. Pleasant light scent that doesn't linger. I get my moister from other products so this one idk if it moisturizes by itself. Good value for the money, you get a lot so it lasts awhile.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Michelle W.
Port Orchard, US
★★★★★ 4
Love! Smell is nice, helps with dry skin
Scent: Cucumber, Size: 12 Fl Oz (Pack of 1)
I have been using Thayers for years. My skin is sooo dry and tight post shower. I put this in a small mister bottle, and Mist my face. Scalp- my scalp gets itchy, I use this, witch hazel, apple Cider Vinegar and water in a dropper. Works amazing!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
A
Verified Purchase
Austin campbell
Whiting, US
★★★★★ 5
Great rose toner!
Scent: Rose Petal, Size: 12 Fl Oz (Pack of 1), Scent: Rose Petal, Size: 12 Fl Oz (Pack of 1)
As an aesthetician, this is my go to over the counter toner. Rose is great for your skin and the ingredients in this are great. I am extremely sensitive, and this does not irritate my skin at all. It keeps it soft and clear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products