Human IL-6
SKU: 87453694332

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 87453694332

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1169 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sherry Graber
Grantham, US
★★★★★ 5
Check size guide before buying but a great dress!
Size: Medium, Color: Pink
Check size guide before ordering. Had to return for a larger size. Overall great quality, comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
D
Verified Purchase
dandeven
Waukegan, US
★★★★★ 5
Adorable but runs small
Size: Medium, Color: Black/Ivory, Size: Medium, Color: Black/Ivory
These are the cutest shirts- cotton, soft, thick- good quality but SMALL. Returned because of size and ordered a bigger size. I added a picture for reference- the other is a cotton 7-8 from Disney - I feel like the M /8 amazon was more a 6. I definitely recommend these shirts though just size up at least one size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
C
Verified Purchase
CCR
Lake Worth, US
★★★★★ 5
Good value, runs small
Size: X-Small, Color: Mauve/Butterflies
Runs small. Great shirts and value otherwise.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
R
Verified Purchase
Robare
Lowell, US
★★★★★ 5
Gift for granddaughter
Size: Large, Color: Mauve/Butterflies
My granddaughter likes these tops. They are sturdy, comfortable and soft. She loves the ruffles on the shoulder. They were reasonably priced and I feel they will last. Look good after a number of washes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
C
Verified Purchase
Careem Corbett
Birmingham, US
★★★★★ 3
Shrank after one wash
I wanted to love these but they shrank in the washer after one wear. Now they are above my daughters wrist, too small. They do feel good, and have a nice thickness. From initial unpackaging I expected we’d have these in rotation for a while. Looks and feels like a quality buy, until washing. I’ll be saving them for a younger child but my intention was for the oldest. I’ve been trying out the Amazon Essentials brand clothing for kids. Seems to be hit or miss, haven’t come across anything I absolutely love.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2026

recommand products