Human IL-12A, His tag
SKU: 92221628047

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92221628047

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 893 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Port Orchard, US
★★★★★ 5
Excellent stuff!
Style: 18oz
Used this on a Z-Trac with a flat and it fixed it and has held up for over 8 months.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
J
Verified Purchase
John V. Green
Waukegan, US
★★★★★ 5
Greats stuff
Style: 14oz
Works super, has kept air steaycfor over 6 months, no leaks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
C
Verified Purchase
Chris_9725
Dallas, US
★★★★★ 4
Effective temporary fix
Style: 18oz, Style: 18oz
The slim brand has always been an genuine effective fix. I have been using slime since I used to ride on bicycles. Well it is not a permanent fix for if you have a hole in your inner tube it is a great fix to hold you over until you are able to get to either the mechanic or to your local store to get a replacement inner tube. Overall, it's worth every penny and you get plenty in the canister that it comes in depending on which slime you are getting whether that's the plastic bottle for your inner tubes for a bicycle or the metal canister as I've shown in my picture for your SUVs trucks or vans. However I don't give this an entire five stars but more of four stars not because of their product but because resorting to using slime rather than fixing the problem is more of my own problem. ⭐⭐⭐⭐ 👍👍
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2024
C
Verified Purchase
Chara P.
Louisville, US
★★★★★ 1
Don't buy doesn't work
Style: 18oz, Style: 18oz
Terrible did nothing. Even tried to let wheel turn 360 degrees yet the solution get in the tire leak proper. Directions on can differ from instructions on here/Amazon. I followed directions on can EXACTLY and still didnt even hold one PSI of air. I'd be better off burning the $10 for warmth rather then waste it this way
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
K
Verified Purchase
Keith S
Port Orchard, US
★★★★★ 5
Amazing stuff
Style: 14oz
I’ve been using this stuff for a number of years for a number of vehicles now and it works every time. It’s especially great with those small annoying leaks where you just lose a couple pounds every few days so you have to keep adding air like once a week. It totally seals it. The bottle says to only rely on it for 300 to 500 miles and then get a proper fix. However, I have not found this to be the case. The seal holds for the rest of the life of my tire every time I’ve used it. My only complaint is that I wish it was a little cheaper, but you can seal up 2 tires (use only half the can per tire - you can probably even get away with using less). There is a garage not far from me that fixes leaking tires for $10, which is the same price as this product so not really saving any money by using it. It’s more just a matter of convenience. Just make sure you get this “thru-core” one. They have other ones as well so it can get confusing, but the one you’d want for situations like I’ve described above (small to medium leak in a typical passenger vehicle) is this “thru-core” one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2023

recommand products