Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 4 - Jul 9
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human BTN3A1, hFc tagProduct Specification Species Human Synonyms Butyrophilin subfamily 3 member A1, CD277, BTF5 Accession O00481 Amino Acid Sequence Protein sequence (O00481, Gln30 Gly254, with C hFc)
Product Specification
| Species | Human |
| Synonyms | Butyrophilin subfamily 3 member A1, CD277, BTF5 |
| Accession | O00481 |
| Amino Acid Sequence | Protein sequence (O00481, Gln30-Gly254, with C-hFc) QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 50.2 kDa Observed MW: 55 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-hFc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Human butyrophilin subfamily 3 member A (BTN3A), also known as CD277, includes isoforms BTN3A1, BTN3A2, and BTN3A3 and is structurally associated with B7 costimulatory molecules. Each BTN3A isoform consists of an extracellular N-terminal Ig variable (V) domain and a near-membrane Ig constant (C) region connected to a single transmembrane domain. BTN3A family members have emerged as important molecules modulating the function of Vγ9Vδ2 T cells. The B30.2 intracellular domain plays an important role in this process. Only the intracellular B30.2 domain of BTN3A1 directly binds phosphorylated antigens (pAgs) through a positively charged pocket to activate Vγ9Vδ2 T cells. BTN3A1 is expressed in many tumors, such as ovarian cancer, bladder cancer, breast cancer, renal cell carcinoma and pancreatic ductal adenocarcinoma. The prognostic role of BTN3A1 in different cancers varies substantially.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 751 reviews
Sort
Product Reviews
★★★★★ 5
Incredible robot.
Size: 11S MAX, Size: 11S MAX
I have had this vacuum for nearly a year now, running it on an automatic schedule every single day, and I am so grateful for this product and how it has improved my quality of life.
This vacuum and its automatic schedule has meant that I rarely see any dust or dog hair on my floor and I no longer have to take the time to vacuum. The amount of dust this machine collects is unbelievable- the photo I included of the yield is from HALF of a cycle.
Flooring/obstacles
I use my eufy on hard floor and short carpet and it works wonderfully. It does snag on high pile rugs so I try to put my bathroom mat up when I remember.
Eufy does get stuck on things so it took some time to determine what picking up I need to do before it’s “shift.” This has not been a nuisance, it’s more of a good motivation to do a quick cleanup.
Durability
Also, long hair is a challenge and I do have to cut it out of the brush head about once a week. I also recently replaced the brush head which was a great reset. The side spin brush also broke down over a few months and replacing that REALLY improved the power of the machine. I’ll be replacing it as soon as I notice breakage now.
Noise
I think it has gotten a bit louder over the year I have owned it. I used to be able to sleep through the noise, now it’s a bit too loud for me especially as it gently bangs against the walls (doesn’t scuff though).
Overall, this is a gift and I will never not have one for the rest of my life
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
★★★★★ 5
BEST ROBOVAC EVER!
Size: 11S MAX
This is BEST Robovac you'll ever own, IMHO.
I purchased the first robovac made by a different company when these little things were a completely new concept. This is BEST Robovac you'll ever own, IMHO. I purchased the first robovac made by a different company when these little things were a completely new concept. It was such a surprise as to how good it was, and how it made a difference in time spent housekeeping every day. I've been a fan ever since (20+ yrs) and have tried many different brands and models. The Eufy is the best! And I have purchased 3 of this model.
Depending upon your budget and specific needs, there are things I've learned, and I'm going to break those points down for your consideration. Possibly they may apply to your situation. These points are some requirements that make all the difference to me and my lifestyle. ~~>
#1. Two auxiliary brushes.: This is the most important thing for me and is a no brainer, IMHO. The two brushes, one on each side of the front edge (approx 11 and 2 o'clock) sweep the debris to the underneath center of the unit where it is sucked up. Because there are two, they sweep a larger area, and because the vac covers the same areas more than once, you get better cleaning results. This is very important in kitchens and high traffic areas. Also corners are swept from both sides.
#2. Undercarriage rotating beater brush: I have both carpeted and uncarpeted areas. I need more than just suction to lift dust, pet hair, dirt, and debris from my floors. My kitchen does not have carpet so an undercarriage beater brush is not a requirement, but my Family room has carpeting, and my Living room has Oriental wool and silk rugs. They need a light agitation to help lift up the dust so the vacuum can easily suction it up. A beater brush is a major requirement for my floors for this reason.
#3 Scheduling option: this is WONDERFUL! Our major living areas are scheduled to vacuum after we've gone to bed, and our bedrooms and bathrooms are scheduled while we are gone during the day. Happy feet!
#4. Rechargeable on its own! Need I say more? It goes back to the recharging station to recharge itself when it needs more juice. YAY! We live on three floors, and this is a huge plus for us.
#5. The Customer service with this company is amazing! If you have any issues, regardless of how small, they will get back to you, and immediately help. They respond, and do not merely send you to a FAQ link.
#6. It is gentle and does not smack into your furniture, scuffing it.
#7. The more you use it, the cleaner your house will be. Regular dusting is done on a daily basis so there is less and less dirt and dust to deal with. It is amazing the difference! Weekend freedom!
#8. You do not have to do much prep at all, just check for loose cords to not become tangled. When I bought my first robovac I didn't use it too often because I was unnecessarily moving furniture, rugs, floor lamps, trash cans, etc. Then one day, I left a door open and the robovac sneaked out of the room I'd religated it to. When I returned home, the little vac had done my whole house (single level @ 2000 sq feet) and it was GREAT. I realized that all I needed to do from then on was to let it go do its thing. Lesson learned.
My Eufys are my workhorses and I recommend this little gem of a vac if you are considering it. IMHO It will be a good investment. It has been for me, and my family (including cats and dogs).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2025
★★★★★ 4
Absolute worth the money
Size: 11S MAX
The RoboVac works well for me.
Very easy to use, not noisy, easy to empty dust collector out, picks up dust and crumbs etc. better than expected. It works on its own from room to room and transitions just fine from hard to soft surfaces. It even manages my higher pile carpet in some rooms. It‘s not heavy, so I use it upstairs and downstairs, just carry it up or down, plug in and start it. Easy!
It works best if you get all cords and anything that it could caught up in out of its way beforehand.
Sometimes it gets itself ‚ worked up’ and goes over one area several times which is weird.
My house ist quite big and if it works over one area over and over, it does not have enough battery life to do the entire ~16000 sqft. floor on one level with different rooms and changing surfaces (I expected this, no prob. for me).
The vacuum results are not as good as using a Miele canister vacuum ( my other vacuum) but good enough so the Miele only has to be pulled out from time to time for a deep vacuuming.
I would buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2021
★★★★★ 5
Good Value
Size: 11S MAX
Works as advertised. Quiet and efficient. The price was competitive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
★★★★★ 1
Customer service –4 stars. Vacuum, 5 stars
Size: 11S MAX, Size: 11S MAX
I received the wrong remote control for this product. It doesn't work with the vacuum at all. I called Eufy customer support twice. The 1st time, after I told them the issue with the remote, they would put me on a 3 minute hold, come back and ask me the same question. This happened 3 times. They then asked me for my email address so I could send them the picture of the remote. They told me to stay on hold but the call disconnected and I never received the email to send them the pictures. The 2nd time I called them I told them the same issue with the remote, they put me on a 25 minute hold and they never came back. I instead received an automated survey message to let them know how they did. They did poorly. Massive waste of time. I didn't want to return the whole vacuum just because of the remote. It's refurbished and the vacuum itself works very well! All I need is the correct remote.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026