Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
IL-7 Protein, HumanProduct Specification Species Human Synonyms Interleukin 7 Accession P13232 Amino Acid Sequence Asp26 His177 with C terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH Expression System HEK293 Molecular Weight 18 30 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU mg Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Synonyms | Interleukin-7 |
| Accession | P13232 |
| Amino Acid Sequence |
Asp26-His177 with C-terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 18-30 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/mg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 10 mM PBS, pH 7.4. |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6. |
Background
Interleukin 7（IL-7）is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.
IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.
IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy