Human IL-12A, His tag
SKU: 24734907685

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 5 - Jul 10

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24734907685

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 1509 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
mando
Lake Worth, US
★★★★★ 5
Unicorn sunscreen
Color: Tinted (1.7 oz)
I've used at least three bottles of both the body and face sunscreens by this line. It's honestly a unicorn sunscreen. Actually clean ingredients, over 18% zinc oxide, which apparently is the minimum needed to actually combat harmful rays, affordable, actually sinks into the skin and doesn't leave a white cast, AND my kids don't complain when I apply it to them. I use very high-end facial products and I've added this very affordable sunscreen to my daily routine and have been extremely impressed. Highly recommend and I'm so glad I found it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
R
Verified Purchase
runner 65
Dallas, US
★★★★★ 1
not good
Color: Tinted (1.7 oz)
smelled and pilled i returned it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
J
Verified Purchase
Jodi
Dallas, US
★★★★★ 5
Great product
Color: Untinted (1.7 oz)
Great product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
R
Verified Purchase
Ryan
Charlottesville, US
★★★★★ 2
Pills up on skin
Color: Untinted (1.7 oz)
I’m on the hunt for the perfect mineral sunscreen for my face because the non mineral kind irritates my eyes. This had good reviews so I figured I’d give it a try. I’m disappointed. Pros: It is a mineral sunscreen. The pump application is nice and works well. I like that it had skincare in it. It feels like moisturizer in my hand. Unfortunately it doesn’t behave that way on my face. Cons: It smells like diaper rash cream. This isn’t entirely a problem on its own, and being a mineral sunscreen I wasn’t surprised. But I’ve used others that don’t smell like this. It pills like crazy. I’ve tried multiple ways of applying it, and I can’t keep it from pilling up on my skin like I’ve just used Dr Melaxin’s peel shot. By the time I wipe off all the little pills, I’m sure I’ve wiped away the sun protection. I won’t buy this again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
A
Andria
West Palm Beach, US
★★★★★ 4
Clean ingredients
Color: Untinted (1.7 oz)
Good product. Runs a little thick like every sunscreen with zinc in it. thankfully has great ingredients and there is no beefy smell like some tallow brands. Enjoyable product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products