Human E-selectin, His tag
SKU: 90567121434

Human E-selectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human E-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM 1), Leukocyte endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 Accession P16581 Amino Acid Sequence Protein sequence (P16581, Trp22 Pro556, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM-1), Leukocyte-endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1
Accession P16581
Amino Acid Sequence

Protein sequence (P16581, Trp22-Pro556, with C-10*His) WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 60.3 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

E-selectin is a selectin cell adhesion molecule expressed only on endothelial cells activated by cytokines. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. E-selectin binding to colon cancer cells correlates with increasing metastatic potential. Cancer cells of multiple tumor types bind E-selectin using glycoprotein or glycolipid ligands normally expressed on immune cells that eventually results in a tight binding between tumor cells and the activated endothelium. In addition, E-selectin may also function to recruit monocytes to primary tumors or lung metastases to promote an inflammatory pro-tumor microenvironment. E-selectin is an emerging biomarker for the metastatic potential of some cancers including colorectal cancer and recurrences. In cases of elevated blood glucose levels, such as in sepsis, E-selectin expression is higher than normal, resulting in greater microvascular permeability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90567121434

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2018 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Reading Rainbow Trout
Chelsea, US
★★★★★ 5
Better than the movie
Format: Kindle
I really loved this book. The Disney movie was clearly only very loosely based on this wonderful story. I’m actually kinda mad I ever saw the movie because it kept me from the book for so long.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
K
Verified Purchase
Kikyo C.
Dallas, US
★★★★★ 5
A fairytale classic made even better!
Format: Paperback
Embellishing on the original tale of Cinderella, Gail Levine has written an imaginative and touching story - a classic in its own right. While the traditional fairytale focuses on the magical rags-to-riches transformation of a scullery maid into a princess, Levine's heroine is very real in both her defeats and her triumphs. Ella is a wonderful character whose unwavering sense of humor and refusal to succumb make her an endearing heroine whom the reader eagerly follows through her journeys. The friendship that she shares with Prince Char, her struggles to break the curse placed on her at birth, the pain and the joy that she feels at each turn of events are drawn with a clarity and poignant charm that make this a unique story all its own. There is, of course, glass slippers, a ball, the pumpkin coach - but this story goes far beyond the original to become something more. It is not just about one magical night that makes a servant into a princess; it is about the life of a girl who is more than what she seems and has only to realize it for herself to make her wishes come true. Ella Enchanted is a wonderful story for readers of all ages, and there is an amazing depth to this tale that cannot help but make you think. Despite the omnipresent existence of magic and the whimsical creatures that include everything from gnomes and elves to giants and ogres, the focus of the story is very real. We are, each of us, a little bit like Ella - struggling to be who we are while everything around us tries to make us otherwise. I strongly recommend this book to anyone who loves fairytales and children's books - especially to anyone who loves the story of Cinderella.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2000
J
Verified Purchase
Jacqueline Cortez
Port Orchard, US
★★★★★ 5
Timeless
Format: Hardcover
My first born daughter is literally named Ella after Ella Enchanted. This is the most meaningful children’s book I ever experienced in childhood and it continues to hold up as I have reread it to my Ella in parenthood. It’s still so fun and magical and heartfelt. Thank you Gail Carson Levine for this literary gem!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 25, 2025
C
Verified Purchase
cat
Battle Creek, US
★★★★★ 4
Beloved childhood classic for a reason
Format: Paperback
Not to give away my age, but I owned this book when I was younger and lent it to a friend and never got it back. I finally gave into my desire to own it again and purchased it from amazon. I'm so happy that I did. This book definitely holds up even after all these years. It's this kind of writing that helped me fall in love with the idea of being a writer. I've read some of Gail Carson Levine's other books and enjoyed them to varying degrees. I remember reading The Wish and thinking, even as a child, that it was incredibly bland. But Ella Enchanted is truly one of her gems. It is heartfelt and well-written with a truly wonderful heroine. Now that I'm older I do see more of the problems. The writing is a lot simpler than I remember but I suppose that it needs to be for the reading level of the target audience so I won't count that as a negative. As with most young adult novels, it is on the shorter side. This leads to some awkward pacing and a lack of development. There's not really enough of her friend Areida or her adventures. The romance with Char is underdeveloped though conveyed skillfully enough that by the end I was very invested in the outcome. The ending and epilogue after the dramatic conclusion also come across as a little rushed. Still, I think it's a wonderful story for young girls and a truly inspiring heroine for them to identify with. For older readers, it's a pleasant diversion. The strength of the story is Ella and the way Levine writes the scenes that are meant to have a big emotional impact. I understand when people say the story meanders a bit and how it could be boring for some people. Levine doesn't do a great job with descriptions despite the complexity of the world she's imagined. It's difficult to really picture anything in your head based on the descriptions she gives. She's not a world-builder like the big name fantasy writers. She's more interested in the characters and the main plot arc for the heroine. I would recommend this book for a reader or parent looking for a strong, believable female protagonist. It's not a great fantasy novel and it's a little underdeveloped but the individual scenes are well written and the emotion, lesson, and strong character arc are there. I'd also recommend getting the new version as there are great extras including information about the languages Levine developed for the various creatures in the world of Ella Enchanted. I don't remember these being included in the first edition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 20, 2012
E
Verified Purchase
Erwin del Rosario
Los Angeles, US
★★★★★ 5
Little golden book Hawkeye
Format: Hardcover
A nice marcel book to keep
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026

recommand products