Human IL-6
SKU: 52230077947

Human IL-6

Sale price$180.00 Regular price$200.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6Product Specification Species Human Synonyms Interleukin 6, B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2), IL6, IFNB2 Accession P05231 Amino Acid Sequence Protein sequence (P05231, Val30 Met212)

Product Specification


Species Human
Synonyms Interleukin-6, B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IL6, IFNB2
Accession P05231
Amino Acid Sequence

Protein sequence (P05231, Val30-Met212) VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Expression System HEK293
Molecular Weight

Predicted MW: 20.8 kDa Observed MW: 20, 21 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 6 (IL-6) is an interleukin that acts as both a pro-inflammatory cytokine and an anti-inflammatory myokine. Osteoblasts secrete IL-6 to stimulate osteoclast formation. Smooth muscle cells in the tunica media of many blood vessels also produce IL-6 as a pro-inflammatory cytokine. IL-6's role as an anti-inflammatory myokine is mediated through its inhibitory effects on TNF-alpha and IL-1 and its activation of IL-1ra and IL-10. There is some early evidence that IL-6 can be used as an inflammatory marker for severe COVID-19 infection with poor prognosis, in the context of the wider coronavirus pandemic. IL-6 stimulates the inflammatory and auto-immune processes in many diseases such as multiple sclerosis, neuromyelitis optica spectrum disorder (NMOSD), diabetes, atherosclerosis, depression, Alzheimer's disease, systemic lupus erythematosus, multiple myeloma, prostate cancer, Behçet's disease, rheumatoid arthritis, and intracerebral hemorrhage.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 52230077947

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 1239 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
REALiZEx
Grantham, US
★★★★★ 5
Work just like the originals
Color: 14Pcs Eufy E25/E28/C28 Bags
Work just like the originals. Will buy again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2025
C
Verified Purchase
Chris H
Charlottesville, US
★★★★★ 5
It fits
Color: 14Pcs Eufy E25/E28/C28 Bags
Fits my eufy 25 perfectly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2025
J
Verified Purchase
joseph torres
West Palm Beach, US
★★★★★ 5
Precise fit
Size: Eufy E25 Omni / E28 Omni E28
Perfect fit for eufy E28 system Follow instructions and you will be a happy camper.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
M
Matt M.
Pawtucket, US
★★★★★ 5
Decent Accessory Kit
Size: Eufy E25 Omni / E28 Omni E28, Size: Eufy E25 Omni / E28 Omni E28
This is a decent accessory kit I got for my E28! This kit comes with so many of the parts I needed to keep my E28 up and cleaning well. The accessories each fit my bot very well - the roller brush slid on with no issue and it didnt bind in any way. The knap on the brush is decent (a bit knappier than the OEM). This is nice because I have textured tile so a better knap will help clean inside the nooks and crannies. The kit comes with a lot of the needed items for the bot. One negative (but I didnt take away a star because this can happen in others as well) was that the cardboard on the dust bag didnt have enough glue to keep the bag on the stock board - it tore away super easily which was a bummer to lose a whole bag. Not the end of the world, but be carful inserting the bag properly to avoid tearing it away/open. All in all this is a decent kit and is a fraction of the price of others. Additionally, it is one of the least expensive kits on Amazon, which is nice - because we all could stand to save a buck or two.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
T
TSR
Whiting, US
★★★★★ 5
Eufy Replacement Parts
Size: Eufy E25 Omni / E28 Omni E28, Size: Eufy E25 Omni / E28 Omni E28
The 14-piece replacement parts for the Eufy E25 Omni made a huge difference. It came with a roller mop, roller bushes, air filters, and dust bags. I hadn’t replaced any of my parts for quite a while and the vacuum was starting to not work very well. I ordered this set hoping for the best and was really impressed by the quality of the parts. Everything worked beautifully and installation was a breeze. After just a few seconds I replaced everything that needed to be changed and was scheduling for a cleaning. The new parts made a big difference in how well the vacuum performed and I couldn’t believe how much cleaner the floor was. I am totally happy with my order and will continue to use these parts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products