Human Jagged1, His tag
SKU: 23993764653

Human Jagged1, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Jagged1, His tagProduct Specification Species Human Synonyms hJ1, CD339, JAG1, JAGL1 Accession P78504 Amino Acid Sequence Protein sequence (P78504, Ser32 Ile335, with C 10*His)

Product Specification


Species Human
Synonyms hJ1, CD339, JAG1, JAGL1
Accession P78504
Amino Acid Sequence

Protein sequence (P78504, Ser32-Ile335, with C-10*His) SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 35.4 kDa Observed MW: 44 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Jagged1 (JAG1) is one of five cell surface proteins (ligands) that interact with four receptors in the mammalian Notch signaling pathway. The Notch Signaling Pathway is a highly conserved pathway that functions to establish and regulate cell fate decisions in many organ systems. Once the JAG1-NOTCH (receptor-ligand) interactions take place, a cascade of proteolytic cleavages is triggered resulting in activation of the transcription for downstream target genes. JAG1 gene is expressed in multiple organ systems in the body and causes the autosomal dominant disorder Alagille syndrome (ALGS) resulting from loss of function mutations within the gene. ALGS is an autosomal dominant multi-system disorder affecting several body systems including the liver, heart, skeleton, eye, facial structure, kidneys and vascular system. JAG1 expression changes have been implicated in many types of cancer. Up regulation of JAG1 has been correlated with both poor overall breast cancer survival rates and an enhancement of tumor proliferation in adrenocortical carcinoma patients.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23993764653

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 662 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Jackiee
Massapequa, US
★★★★★ 5
this pillow does work
For months my neck had been brothering me every morning when I woke up. Figured it was stress and I always planned on getting a massage. But I never did it. I ended up seeing this pillow on Amazon and got it. It was almost an instant 180. My neck pain is gone! This pillow is stuffed very full but isn't super firm. It's a bit hard to describe. The seams are well sewn and the pillow has held up very well for a week now. No weird smells or any type of red flag that I found. It's easy to flip and reshape in an instant.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2025
P
Pamdirac
Battle Creek, US
★★★★★ 5
Comfortable to use with firm support
This set of queen-size pillows has a great balance between softness and support. The down alternative fill feels plush and comfortable. The pillows also provide enough firmness to support the neck and shoulders. A better sleep quality achieved with less tossing and turning. For sleeping on side, back, or stomach, the pillows keep their shape and offer consistent comfort. A good choice for the improvement of sleep quality with more comfort.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2025
L
Verified Purchase
ladyesmiles
Lexington, US
★★★★★ 5
Very comfortable and supportive.
I really am quite amazed with these pillows. As with most people who suffer from neck and back pain it's almost impossible to find a comfortable pillow. One year I must have went through 20 sets trying to find the right pillow. I received these and they were flat in the package. All you have to do is take them out and fluff them up a little bit with your hand and let them sit overnight. What's really nice about these is they are soft and cushy but they have a support that does not flatten when you lay down. Of note when I was looking for pillows, I noticed that these had a price of $110 which was crossed out and then a huge discount. Looking at the item now I see that the top price for the king size is $42. So I'm going to say that $110 was a comparison of what a good pillow might cost. I do want you to know that a set of pillows that I had been using were $200 a piece and these are very comparable to that. I am not having any issues overheating with these as I have a very nice cover on them. They are washable. My neck feels totally better. So all in all I am quite impressed with these pillows and very surprised that the first set I ordered is working perfectly for me. I am a side sleeper and needed my neck to be straight and these do the job with a nice little cushion on them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
K
Verified Purchase
Kathleen Regan
Cuba, US
★★★★★ 5
The BEST pillow you will ever sleep on!!
The BEST pillow you will ever purchase!! Right amount of firmness and support yet soft!! Quite the sleep enhancer!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
G
Verified Purchase
Gardening 1
New York, US
★★★★★ 1
FLAT
Flat as a pancake. No support. No fluff. very incomfortable. Returning,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products